Lineage for d5yiyb_ (5yiy B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529423Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2529424Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2529517Family c.123.1.0: automated matches [267628] (1 protein)
    not a true family
  6. 2529518Protein automated matches [267679] (4 species)
    not a true protein
  7. 2529533Species Mycobacterium tuberculosis [TaxId:83332] [360005] (3 PDB entries)
  8. 2529539Domain d5yiyb_: 5yiy B: [360043]
    automated match to d4ed9a_
    complexed with cl; mutant

Details for d5yiyb_

PDB Entry: 5yiy (more details), 2.5 Å

PDB Description: crystal structure of d175a mutant of rv3272 from mycobacterium tuberculosis
PDB Compounds: (B:) CoA transferase

SCOPe Domain Sequences for d5yiyb_:

Sequence, based on SEQRES records: (download)

>d5yiyb_ c.123.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrpplat
yflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpn
liyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasghvlaq
avlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakrrkgv
gfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinyaelta
elelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadtitvir
tparyasfravvtdppptagehnavflar

Sequence, based on observed residues (ATOM records): (download)

>d5yiyb_ c.123.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpatyflpn
nrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyar
ltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasghvlaqavlaa
llhrerngvadvvqvamydvavglqanqlmmhlnatqpsdafrtadgyivisayvpkhwq
klcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmacla
htwkqvvdtplfaendltlevgrgadtitvirtparyasfravvtdppptagehnavfla
r

SCOPe Domain Coordinates for d5yiyb_:

Click to download the PDB-style file with coordinates for d5yiyb_.
(The format of our PDB-style files is described here.)

Timeline for d5yiyb_: