Lineage for d5yiyb_ (5yiy B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. Family c.123.1.0: automated matches [267628] (1 protein)
    not a true family
  6. Protein automated matches [267679] (4 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [360005] (3 PDB entries)
  8. Domain d5yiyb_: 5yiy B: [360043]
    automated match to d4ed9a_
    complexed with cl; mutant

Details for d5yiyb_

PDB Entry: 5yiy (more details), 2.5 Å

PDB Description: crystal structure of d175a mutant of rv3272 from mycobacterium tuberculosis
PDB Compounds: (B:) CoA transferase

SCOPe Domain Sequences for d5yiyb_:

Sequence, based on SEQRES records: (download)

>d5yiyb_ c.123.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrpplat
yflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpn
liyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasghvlaq
avlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakrrkgv
gfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinyaelta
elelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadtitvir
tparyasfravvtdppptagehnavflar

Sequence, based on observed residues (ATOM records): (download)

>d5yiyb_ c.123.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpatyflpn
nrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyar
ltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvanasghvlaqavlaa
llhrerngvadvvqvamydvavglqanqlmmhlnatqpsdafrtadgyivisayvpkhwq
klcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmacla
htwkqvvdtplfaendltlevgrgadtitvirtparyasfravvtdppptagehnavfla
r

SCOPe Domain Coordinates for d5yiyb_ are not available.

Timeline for d5yiyb_:

Domains from other chains:
(mouse over for more information)
d5yiya_