Lineage for d5znda_ (5znd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2313377Protein automated matches [190041] (30 species)
    not a true protein
  7. 2313645Species Human (Homo sapiens) [TaxId:9606] [187027] (36 PDB entries)
  8. 3059980Domain d5znda_: 5znd A: [360042]
    automated match to d5goug_

Details for d5znda_

PDB Entry: 5znd (more details), 3 Å

PDB Description: 8-mer nanotube derived from 24-mer rhuhf nanocage
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5znda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5znda_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
nqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdkndphlcdf

SCOPe Domain Coordinates for d5znda_:

Click to download the PDB-style file with coordinates for d5znda_.
(The format of our PDB-style files is described here.)

Timeline for d5znda_:

  • d5znda_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08