Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [360039] (3 PDB entries) |
Domain d5zz6a1: 5zz6 A:9-79 [360040] Other proteins in same PDB: d5zz6a2, d5zz6b2, d5zz6c2, d5zz6d2 automated match to d1r72e3 complexed with adp, nad |
PDB Entry: 5zz6 (more details), 2.2 Å
SCOPe Domain Sequences for d5zz6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zz6a1 a.4.5.0 (A:9-79) automated matches {Thermotoga maritima [TaxId: 243274]} vskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgvgynveh lydaigeilgv
Timeline for d5zz6a1: