SCOPe 2.08: Domain d5zz6a1: 5zz6 A:9-79

Lineage for d5zz6a1 (5zz6 A:9-79)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [360039] (3 PDB entries)

8. Domain d5zz6a1: 5zz6 A:9-79 [360040]
   Other proteins in same PDB: d5zz6a2, d5zz6b2, d5zz6c2, d5zz6d2
   automated match to d1r72e3
   complexed with adp, nad

Details for d5zz6a1

PDB Entry: 5zz6, 2.2 Å

PDB Description: redox-sensing transcriptional repressor rex

PDB Compounds: (A:) Redox-sensing transcriptional repressor Rex 1

SCOPe Domain Sequences for d5zz6a1:

Sequence; same for both SEQRES and ATOM records:

>d5zz6a1 a.4.5.0 (A:9-79) automated matches {Thermotoga maritima [TaxId: 243274]}
vskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgvgynveh
lydaigeilgv

Timeline for d5zz6a1:

• d5zz6a1 first appeared in SCOPe 2.07