Lineage for d6gjja_ (6gjj A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (136 PDB entries)
    Uniprot P05092
  8. Domain d6gjja_: 6gjj A: [360036]
    automated match to d1w8ma_
    complexed with l36

Details for d6gjja_

PDB Entry: 6gjj (more details), 1.3800000000000001 Å

PDB Description: cyclophilin a complexed with tri-vector ligand 2.
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d6gjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjja_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d6gjja_ are not available.

Timeline for d6gjja_: