![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (42 species) not a true protein |
![]() | Species Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId:1560294] [359886] (1 PDB entry) |
![]() | Domain d6fyue_: 6fyu E: [360016] Other proteins in same PDB: d6fyua_, d6fyuc_, d6fyud_, d6fyuf_, d6fyug_, d6fyui_ automated match to d4kdmb_ complexed with na, nag |
PDB Entry: 6fyu (more details), 2.64 Å
SCOPe Domain Sequences for d6fyue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fyue_ h.3.1.0 (E:) automated matches {Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId: 1560294]} aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq
Timeline for d6fyue_: