Lineage for d6fyue_ (6fyu E:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041903Species Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId:1560294] [359886] (1 PDB entry)
  8. 3041905Domain d6fyue_: 6fyu E: [360016]
    Other proteins in same PDB: d6fyua_, d6fyuc_, d6fyud_, d6fyuf_, d6fyug_, d6fyui_
    automated match to d4kdmb_
    complexed with na, nag

Details for d6fyue_

PDB Entry: 6fyu (more details), 2.64 Å

PDB Description: structure of h7(a/shanghai/2/2013) influenza hemagglutinin in complex sd36
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d6fyue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fyue_ h.3.1.0 (E:) automated matches {Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId: 1560294]}
aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq

SCOPe Domain Coordinates for d6fyue_:

Click to download the PDB-style file with coordinates for d6fyue_.
(The format of our PDB-style files is described here.)

Timeline for d6fyue_: