| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
| Protein automated matches [191164] (24 species) not a true protein |
| Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
| Domain d6gm1a1: 6gm1 A:2-126 [360010] Other proteins in same PDB: d6gm1a2, d6gm1a3, d6gm1a4, d6gm1b2, d6gm1b3, d6gm1b4 automated match to d3c8ya2 complexed with 402, fes, mg, sf4 |
PDB Entry: 6gm1 (more details), 2.05 Å
SCOPe Domain Sequences for d6gm1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gm1a1 d.15.4.0 (A:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp
Timeline for d6gm1a1:
View in 3DDomains from other chains: (mouse over for more information) d6gm1b1, d6gm1b2, d6gm1b3, d6gm1b4 |