Lineage for d6fyud_ (6fyu D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776357Species Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId:1560294] [359949] (1 PDB entry)
  8. 2776359Domain d6fyud_: 6fyu D: [360004]
    Other proteins in same PDB: d6fyub_, d6fyuc_, d6fyue_, d6fyuf_, d6fyuh_, d6fyui_
    automated match to d4n62a_
    complexed with na, nag

Details for d6fyud_

PDB Entry: 6fyu (more details), 2.64 Å

PDB Description: structure of h7(a/shanghai/2/2013) influenza hemagglutinin in complex sd36
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6fyud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fyud_ b.19.1.0 (D:) automated matches {Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId: 1560294]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpeip

SCOPe Domain Coordinates for d6fyud_:

Click to download the PDB-style file with coordinates for d6fyud_.
(The format of our PDB-style files is described here.)

Timeline for d6fyud_: