Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId:1560294] [359949] (1 PDB entry) |
Domain d6fyug_: 6fyu G: [360003] Other proteins in same PDB: d6fyub_, d6fyuc_, d6fyue_, d6fyuf_, d6fyuh_, d6fyui_ automated match to d4n62a_ complexed with na, nag |
PDB Entry: 6fyu (more details), 2.64 Å
SCOPe Domain Sequences for d6fyug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fyug_ b.19.1.0 (G:) automated matches {Influenza a virus (a/pigeon/wuxi/0405007g/2013(h7n9)) [TaxId: 1560294]} dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv kqrslllatgmknvpeip
Timeline for d6fyug_: