Lineage for d6fyui_ (6fyu I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743947Domain d6fyui_: 6fyu I: [359992]
    Other proteins in same PDB: d6fyua_, d6fyub_, d6fyud_, d6fyue_, d6fyug_, d6fyuh_
    automated match to d4b5eb_
    complexed with na, nag

Details for d6fyui_

PDB Entry: 6fyu (more details), 2.64 Å

PDB Description: structure of h7(a/shanghai/2/2013) influenza hemagglutinin in complex sd36
PDB Compounds: (I:) Single domain antibody SD36

SCOPe Domain Sequences for d6fyui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fyui_ b.1.1.1 (I:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslklscaasgrtyamgwfrqapgkerefvahinalgtrtyysdsv
kgrftisrdnaknteylemnnlkpedtavyyctaqgqwraapvavaaeyefwgqgtqvtv
s

SCOPe Domain Coordinates for d6fyui_:

Click to download the PDB-style file with coordinates for d6fyui_.
(The format of our PDB-style files is described here.)

Timeline for d6fyui_: