![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
![]() | Protein automated matches [190988] (51 species) not a true protein |
![]() | Species Coxsackievirus a10 [TaxId:42769] [359971] (7 PDB entries) |
![]() | Domain d6iija_: 6iij A: [359972] Other proteins in same PDB: d6iijc_ automated match to d4cdqa_ complexed with sph |
PDB Entry: 6iij (more details), 2.84 Å
SCOPe Domain Sequences for d6iija_:
Sequence, based on SEQRES records: (download)
>d6iija_ b.121.4.0 (A:) automated matches {Coxsackievirus a10 [TaxId: 42769]} dpvediihdalgntarraisgatnvesaadttpsshrletgrvpalqaaetgatsnatde nmietrcvinrngvlettinhffsrsglvgvvnltdggdttgyatwdidimgfvqlrrkc emftymrfnaeftfvtttksgearpymlqymyvppgapkptgrdafqwqtatnpsvfvkl tdppaqvsvpfmspasayqwfydgyptfgqhpetsnttyglcpnnmmgtfavrvvsreas qlklqtrvymklkhvrawvprpirsqpyllknfpnydsskitnsardrssikqan
>d6iija_ b.121.4.0 (A:) automated matches {Coxsackievirus a10 [TaxId: 42769]} dpvediihraisgatnvesaadttpsshrletgrvpalqaaetgatsnatdenmietrcv inrngvlettinhffsrsglvgvvnltdggdttgyatwdidimgfvqlrrkcemftymrf naeftfvtttksgearpymlqymyvppgapkptgrdafqwqtatnpsvfvkltdppaqvs vpfmspasayqwfydgyptfgqhpetsnttyglcpnnmmgtfavrvvsreasqlklqtrv ymklkhvrawvprpirsqpyllknfpnydsskitnsardrssikqan
Timeline for d6iija_: