Lineage for d6hula_ (6hul A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827727Species Sulfolobus solfataricus [TaxId:2287] [225031] (3 PDB entries)
  8. 2827730Domain d6hula_: 6hul A: [359968]
    automated match to d2dzpa_
    complexed with g3p, plp, po4, ser, so4

Details for d6hula_

PDB Entry: 6hul (more details), 2.55 Å

PDB Description: sulfolobus solfataricus tryptophan synthase ab complex
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d6hula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hula_ c.1.2.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
gkmlvvymtlgypnvqsfkdfiigavengadilelgippkyakydgpvirksydkvkgld
iwpliedirkdvgvpiialtyledwvdqlenflnmikdvkldgilfpdllidyiddldki
dgiiknkglknviftspsvpdllihkvskisdlflyygvrpttgvpipvsvkqlinrvrn
lvenklivgfglssesdlrdalsagadgiaigtvfieeierngvksainlvkkfrailde
y

SCOPe Domain Coordinates for d6hula_:

Click to download the PDB-style file with coordinates for d6hula_.
(The format of our PDB-style files is described here.)

Timeline for d6hula_: