![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
![]() | Protein automated matches [190292] (36 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [225031] (3 PDB entries) |
![]() | Domain d6hula_: 6hul A: [359968] automated match to d2dzpa_ complexed with g3p, plp, po4, ser, so4 |
PDB Entry: 6hul (more details), 2.55 Å
SCOPe Domain Sequences for d6hula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hula_ c.1.2.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} gkmlvvymtlgypnvqsfkdfiigavengadilelgippkyakydgpvirksydkvkgld iwpliedirkdvgvpiialtyledwvdqlenflnmikdvkldgilfpdllidyiddldki dgiiknkglknviftspsvpdllihkvskisdlflyygvrpttgvpipvsvkqlinrvrn lvenklivgfglssesdlrdalsagadgiaigtvfieeierngvksainlvkkfrailde y
Timeline for d6hula_: