![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:28450] [359966] (1 PDB entry) |
![]() | Domain d6hs3a_: 6hs3 A: [359967] automated match to d4wbsb_ complexed with cl |
PDB Entry: 6hs3 (more details), 2.4 Å
SCOPe Domain Sequences for d6hs3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hs3a_ c.37.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} tsslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagdi slngspislmpihkraslglsylpqeasvfrkltveqnvravlelqhdengkrlskdaig artealleelqiahlrenpalslsggerrrveiaralasnpsfilldepfagvdpiavle iqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlasgapkeiienesvrrvyl gehfrm
Timeline for d6hs3a_: