![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId:464623] [343253] (2 PDB entries) |
![]() | Domain d6fyta_: 6fyt A: [359960] Other proteins in same PDB: d6fytb_, d6fyti_ automated match to d5t0ba_ complexed with nag |
PDB Entry: 6fyt (more details), 2.8 Å
SCOPe Domain Sequences for d6fyta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fyta_ b.19.1.0 (A:) automated matches {Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId: 464623]} gdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncsvag wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh hppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdti ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti gecpkyvrsaklrmvtglrnip
Timeline for d6fyta_: