Lineage for d1cgka2 (1cgk A:236-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. Protein Chalcone synthase, C-terminal domain [419031] (1 species)
  7. Species Alfalfa (Medicago sativa) [TaxId:3879] [419515] (16 PDB entries)
    Uniprot P30074
  8. 2917071Domain d1cgka2: 1cgk A:236-389 [35996]
    Other proteins in same PDB: d1cgka1
    complexed with nar

Details for d1cgka2

PDB Entry: 1cgk (more details), 1.84 Å

PDB Description: chalcone synthase from alfalfa complexed with naringenin
PDB Compounds: (A:) protein (chalcone synthase)

SCOPe Domain Sequences for d1cgka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgka2 c.95.1.2 (A:236-389) Chalcone synthase, C-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

SCOPe Domain Coordinates for d1cgka2:

Click to download the PDB-style file with coordinates for d1cgka2.
(The format of our PDB-style files is described here.)

Timeline for d1cgka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cgka1