![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
![]() | Domain d6glzb1: 6glz B:2-126 [359951] Other proteins in same PDB: d6glza2, d6glza3, d6glza4, d6glzb2, d6glzb3 automated match to d3c8ya2 complexed with 402, fes, mg, sf4 |
PDB Entry: 6glz (more details), 2.02 Å
SCOPe Domain Sequences for d6glzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6glzb1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]} ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras kpflp
Timeline for d6glzb1:
![]() Domains from other chains: (mouse over for more information) d6glza1, d6glza2, d6glza3, d6glza4 |