SCOPe 2.08: Domain d1cgza1: 1cgz A:3-235

Lineage for d1cgza1 (1cgz A:3-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Chalcone synthase, N-terminal domain [419030] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [419514] (16 PDB entries)
   Uniprot P30074

8. Domain d1cgza1: 1cgz A:3-235 [35993]
   Other proteins in same PDB: d1cgza2
   complexed with stl
   has additional insertions and/or extensions that are not grouped together

Details for d1cgza1

PDB Entry: 1cgz, 1.7 Å

PDB Description: chalcone synthase from alfalfa complexed with resveratrol

PDB Compounds: (A:) protein (chalcone synthase)

SCOPe Domain Sequences for d1cgza1:

Sequence; same for both SEQRES and ATOM records:

>d1cgza1 c.95.1.2 (A:3-235) Chalcone synthase, N-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
svseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdk
smikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpks
kithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaennk
garvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

Timeline for d1cgza1:

• d1cgza1 first appeared (with stable ids) in SCOP 1.55
  
• d1cgza1 appears in SCOPe 2.07