Lineage for d6gwub_ (6gwu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883307Species Yeast (Candida albicans) [TaxId:5476] [359877] (1 PDB entry)
  8. 2883309Domain d6gwub_: 6gwu B: [359928]
    automated match to d4o1ja_
    complexed with bme, peg, pge, zn

Details for d6gwub_

PDB Entry: 6gwu (more details), 2.2 Å

PDB Description: carbonic anhydrase cance103p from candida albicans
PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d6gwub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwub_ c.53.2.0 (B:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
kneievwgmlydvatgylsqveipq

SCOPe Domain Coordinates for d6gwub_:

Click to download the PDB-style file with coordinates for d6gwub_.
(The format of our PDB-style files is described here.)

Timeline for d6gwub_: