Lineage for d6acqd1 (6acq D:1-183)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454935Species Clostridium acetobutylicum [TaxId:272562] [359731] (2 PDB entries)
  8. 2454945Domain d6acqd1: 6acq D:1-183 [359926]
    Other proteins in same PDB: d6acqa2, d6acqb2, d6acqb3, d6acqc2, d6acqd2, d6acqe2, d6acqf2, d6acqf3
    automated match to d4kuea1

Details for d6acqd1

PDB Entry: 6acq (more details), 2.5 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase from clostridium acetobutylicum, apo form
PDB Compounds: (D:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6acqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6acqd1 c.2.1.0 (D:1-183) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea
tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls
itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva
eap

SCOPe Domain Coordinates for d6acqd1:

Click to download the PDB-style file with coordinates for d6acqd1.
(The format of our PDB-style files is described here.)

Timeline for d6acqd1: