SCOPe 2.07: Domain d6aa8a2: 6aa8 A:184-280

Lineage for d6aa8a2 (6aa8 A:184-280)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:272562] [359751] (2 PDB entries)

8. Domain d6aa8a2: 6aa8 A:184-280 [359913]
   Other proteins in same PDB: d6aa8a1, d6aa8b1, d6aa8b3, d6aa8c1, d6aa8d1, d6aa8e1, d6aa8f1
   automated match to d4r1na2
   complexed with nad

Details for d6aa8a2

PDB Entry: 6aa8, 2.1 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+

PDB Compounds: (A:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6aa8a2:

Sequence; same for both SEQRES and ATOM records:

>d6aa8a2 a.100.1.0 (A:184-280) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
gfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldiclaimd
vlysetgdskyrphtllkkyvragwlgrksgkgfydy

Timeline for d6aa8a2:

• d6aa8a2 is new in SCOPe 2.07-stable
  
• d6aa8a2 appears in the current release, SCOPe 2.08