Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:272562] [359751] (2 PDB entries) |
Domain d6aa8a2: 6aa8 A:184-280 [359913] Other proteins in same PDB: d6aa8a1, d6aa8b1, d6aa8b3, d6aa8c1, d6aa8d1, d6aa8e1, d6aa8f1 automated match to d4r1na2 complexed with nad |
PDB Entry: 6aa8 (more details), 2.1 Å
SCOPe Domain Sequences for d6aa8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aa8a2 a.100.1.0 (A:184-280) automated matches {Clostridium acetobutylicum [TaxId: 272562]} gfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldiclaimd vlysetgdskyrphtllkkyvragwlgrksgkgfydy
Timeline for d6aa8a2: