Lineage for d6glyb3 (6gly B:210-574)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)
  6. Protein automated matches [279207] (1 species)
    not a true protein
  7. Species Clostridium pasteurianum [TaxId:1501] [279208] (17 PDB entries)
  8. Domain d6glyb3: 6gly B:210-574 [359910]
    Other proteins in same PDB: d6glya1, d6glya2, d6glya4, d6glyb1, d6glyb2
    automated match to d3c8ya1
    complexed with 402, fes, mg, sf4

Details for d6glyb3

PDB Entry: 6gly (more details), 2.09 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant c299a
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d6glyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6glyb3 c.96.1.1 (B:210-574) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsacpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d6glyb3 are not available.

Timeline for d6glyb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d6glyb1, d6glyb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6glya1, d6glya2, d6glya3, d6glya4