Lineage for d6gwvm_ (6gwv M:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. Protein automated matches [190728] (15 species)
    not a true protein
  7. Species Azotobacter vinelandii [TaxId:322710] [258948] (18 PDB entries)
  8. Domain d6gwvm_: 6gwv M: [359906]
    automated match to d2ogxa_
    complexed with atp, cl, so4

Details for d6gwvm_

PDB Entry: 6gwv (more details), 2.8 Å

PDB Description: molybdenum storage protein without polymolybdate clusters and atp
PDB Compounds: (M:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6gwvm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwvm_ c.73.1.0 (M:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
vrpa

SCOPe Domain Coordinates for d6gwvm_ are not available.

Timeline for d6gwvm_:

Domains from other chains:
(mouse over for more information)
d6gwva_, d6gwvb_, d6gwvc_, d6gwvd_, d6gwve_, d6gwvf_, d6gwvg_, d6gwvh_, d6gwvi_, d6gwvj_, d6gwvk_, d6gwvl_, d6gwvn_, d6gwvo_, d6gwvp_, d6gwvq_, d6gwvr_