| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein Chalcone synthase, N-terminal domain [419030] (1 species) |
| Species Alfalfa (Medicago sativa) [TaxId:3879] [419514] (16 PDB entries) Uniprot P30074 |
| Domain d1cmla1: 1cml A:1-235 [35989] Other proteins in same PDB: d1cmla2 complexed with mlc, pin, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1cml (more details), 1.69 Å
SCOPe Domain Sequences for d1cmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmla1 c.95.1.2 (A:1-235) Chalcone synthase, N-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaen
nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp
Timeline for d1cmla1: