| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
| Protein automated matches [229599] (4 species) not a true protein |
| Species Clostridium pasteurianum [TaxId:1501] [279205] (17 PDB entries) |
| Domain d6gm4a2: 6gm4 A:127-209 [359889] Other proteins in same PDB: d6gm4a1, d6gm4a3, d6gm4a4, d6gm4b1, d6gm4b3 automated match to d3c8ya3 complexed with 402, fes, mg, sf4 |
PDB Entry: 6gm4 (more details), 1.97 Å
SCOPe Domain Sequences for d6gm4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gm4a2 d.58.1.0 (A:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks
Timeline for d6gm4a2: