Lineage for d6acqb2 (6acq B:184-280)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334652Species Clostridium acetobutylicum [TaxId:272562] [359751] (2 PDB entries)
  8. 2334660Domain d6acqb2: 6acq B:184-280 [359864]
    Other proteins in same PDB: d6acqa1, d6acqb1, d6acqb3, d6acqc1, d6acqd1, d6acqe1, d6acqf1, d6acqf3
    automated match to d4r1na2

Details for d6acqb2

PDB Entry: 6acq (more details), 2.5 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase from clostridium acetobutylicum, apo form
PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6acqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6acqb2 a.100.1.0 (B:184-280) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
gfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldiclaimd
vlysetgdskyrphtllkkyvragwlgrksgkgfydy

SCOPe Domain Coordinates for d6acqb2:

Click to download the PDB-style file with coordinates for d6acqb2.
(The format of our PDB-style files is described here.)

Timeline for d6acqb2: