SCOPe 2.08: Domain d6acqb2: 6acq B:184-280

Lineage for d6acqb2 (6acq B:184-280)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:272562] [359751] (2 PDB entries)

8. Domain d6acqb2: 6acq B:184-280 [359864]
   Other proteins in same PDB: d6acqa1, d6acqb1, d6acqb3, d6acqc1, d6acqd1, d6acqe1, d6acqf1, d6acqf3
   automated match to d4r1na2

Details for d6acqb2

PDB Entry: 6acq, 2.5 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase from clostridium acetobutylicum, apo form

PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6acqb2:

Sequence; same for both SEQRES and ATOM records:

>d6acqb2 a.100.1.0 (B:184-280) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
gfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldiclaimd
vlysetgdskyrphtllkkyvragwlgrksgkgfydy

Timeline for d6acqb2:

• d6acqb2 first appeared in SCOPe 2.07