SCOP 1.59: Domain d1bi5a2: 1bi5 A:236-389

Lineage for d1bi5a2 (1bi5 A:236-389)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase [53914] (2 proteins)

6. Protein Chalcone synthase [53915] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (13 PDB entries)

8. Domain d1bi5a2: 1bi5 A:236-389 [35986]

Details for d1bi5a2

PDB Entry: 1bi5, 1.56 Å

PDB Description: chalcone synthase from alfalfa

SCOP Domain Sequences for d1bi5a2:

Sequence; same for both SEQRES and ATOM records:

>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa)}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

Timeline for d1bi5a2:

• d1bi5a2 first appeared (with stable ids) in SCOP 1.55
  
• d1bi5a2 appears in SCOP 1.57
  
• d1bi5a2 appears in SCOP 1.61
  
• d1bi5a2 appears in the current release, SCOPe 2.08