Lineage for d6gm0b2 (6gm0 B:127-209)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. Protein automated matches [229599] (4 species)
    not a true protein
  7. Species Clostridium pasteurianum [TaxId:1501] [279205] (17 PDB entries)
  8. Domain d6gm0b2: 6gm0 B:127-209 [359855]
    Other proteins in same PDB: d6gm0a1, d6gm0a3, d6gm0a4, d6gm0b1, d6gm0b3, d6gm0b4
    automated match to d3c8ya3
    complexed with 402, fes, mg, sf4

Details for d6gm0b2

PDB Entry: 6gm0 (more details), 2.11 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant e279q
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d6gm0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gm0b2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d6gm0b2 are not available.

Timeline for d6gm0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gm0b1, d6gm0b3, d6gm0b4
View in 3D
Domains from other chains:
(mouse over for more information)
d6gm0a1, d6gm0a2, d6gm0a3, d6gm0a4