| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
| Protein automated matches [191164] (24 species) not a true protein |
| Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
| Domain d6gm0b1: 6gm0 B:2-126 [359854] Other proteins in same PDB: d6gm0a2, d6gm0a3, d6gm0a4, d6gm0b2, d6gm0b3, d6gm0b4 automated match to d3c8ya2 complexed with 402, fes, mg, sf4 |
PDB Entry: 6gm0 (more details), 2.11 Å
SCOPe Domain Sequences for d6gm0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gm0b1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp
Timeline for d6gm0b1:
View in 3DDomains from other chains: (mouse over for more information) d6gm0a1, d6gm0a2, d6gm0a3, d6gm0a4 |