SCOPe 2.08: Domain d6eaqc1: 6eaq C:5-86

Lineage for d6eaqc1 (6eaq C:5-86)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d6eaqc1: 6eaq C:5-86 [359852]
   Other proteins in same PDB: d6eaqa1, d6eaqa2, d6eaqb1, d6eaqb2
   automated match to d1fnla1

Details for d6eaqc1

PDB Entry: 6eaq, 2.22 Å

PDB Description: glycosylated fcgr3b / cd16b in complex with afucosylated igg1 fc

PDB Compounds: (C:) low affinity immunoglobulin gamma fc region receptor III-b

SCOPe Domain Sequences for d6eaqc1:

Sequence, based on SEQRES records:

>d6eaqc1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkavvflepqwysvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvq
dsgeyrcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records):

>d6eaqc1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkavvflepqwysvlekdsvtlkcqgastqwfhneslissqassyfidaatvqdsgeyr
cqtqlstlsdpvqlev

Timeline for d6eaqc1:

• d6eaqc1 first appeared in SCOPe 2.07