SCOPe 2.08: Domain d6etaa_: 6eta A:

Lineage for d6etaa_ (6eta A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)

8. Domain d6etaa_: 6eta A: [359850]
   automated match to d4gr7a_
   mutant

Details for d6etaa_

PDB Entry: 6eta, 2.2 Å

PDB Description: crystal structure of human gamma-d crystallin mutant p23t+r36s at room temperature

PDB Compounds: (A:) Gamma-crystallin D

SCOPe Domain Sequences for d6etaa_:

Sequence; same for both SEQRES and ATOM records:

>d6etaa_ b.11.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhtnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvid

Timeline for d6etaa_:

• d6etaa_ first appeared in SCOPe 2.07