SCOPe 2.08: Domain d6erma2: 6erm A:148-219

Lineage for d6erma2 (6erm A:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d6erma2: 6erm A:148-219 [359836]
   Other proteins in same PDB: d6erma1
   automated match to d5hgna2
   complexed with azt

Details for d6erma2

PDB Entry: 6erm, 2 Å

PDB Description: hiv hexamer with ligand

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d6erma2:

Sequence, based on SEQRES records:

>d6erma2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d6erma2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac
q

Timeline for d6erma2:

• d6erma2 first appeared in SCOPe 2.07