SCOPe 2.08: Domain d6erma1: 6erm A:1-147

Lineage for d6erma1 (6erm A:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d6erma1: 6erm A:1-147 [359835]
   Other proteins in same PDB: d6erma2
   automated match to d4u0ea1
   complexed with azt

Details for d6erma1

PDB Entry: 6erm, 2 Å

PDB Description: hiv hexamer with ligand

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d6erma1:

Sequence, based on SEQRES records:

>d6erma1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d6erma1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq
aamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmysp

Timeline for d6erma1:

• d6erma1 first appeared in SCOPe 2.07