SCOPe 2.04: Domain d1hnha1: 1hnh A:1-174

Lineage for d1hnha1 (1hnh A:1-174)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)

7. Species Escherichia coli [TaxId:562] [53913] (9 PDB entries)

8. Domain d1hnha1: 1hnh A:1-174 [35983]
   complexed with coa

Details for d1hnha1

PDB Entry: 1hnh, 1.9 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii + degraded form of acetyl-coa

PDB Compounds: (A:) beta-ketoacyl-acyl carrier protein synthase III

SCOPe Domain Sequences for d1hnha1:

Sequence; same for both SEQRES and ATOM records:

>d1hnha1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

Timeline for d1hnha1:

• d1hnha1 first appeared (with stable ids) in SCOP 1.55
  
• d1hnha1 appears in SCOPe 2.03
  
• d1hnha1 appears in SCOPe 2.05
  
• d1hnha1 appears in the current release, SCOPe 2.08