Lineage for d6etbb2 (6etb B:250-401)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2856969Species Escherichia coli [TaxId:83333] [259351] (5 PDB entries)
  8. 2856972Domain d6etbb2: 6etb B:250-401 [359821]
    Other proteins in same PDB: d6etba1, d6etbb1
    automated match to d4d02a2
    complexed with fe, fmn, o, oxy; mutant

Details for d6etbb2

PDB Entry: 6etb (more details), 1.91 Å

PDB Description: aerobic s262y mutation of e. coli flrd core
PDB Compounds: (B:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d6etbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6etbb2 c.23.5.0 (B:250-401) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalapl

SCOPe Domain Coordinates for d6etbb2:

Click to download the PDB-style file with coordinates for d6etbb2.
(The format of our PDB-style files is described here.)

Timeline for d6etbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6etbb1