SCOPe 2.08: Domain d6etbb2: 6etb B:250-401

Lineage for d6etbb2 (6etb B:250-401)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259351] (5 PDB entries)

8. Domain d6etbb2: 6etb B:250-401 [359821]
   Other proteins in same PDB: d6etba1, d6etbb1
   automated match to d4d02a2
   complexed with fe, fmn, o, oxy; mutant

Details for d6etbb2

PDB Entry: 6etb, 1.91 Å

PDB Description: aerobic s262y mutation of e. coli flrd core

PDB Compounds: (B:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d6etbb2:

Sequence; same for both SEQRES and ATOM records:

>d6etbb2 c.23.5.0 (B:250-401) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalapl

Timeline for d6etbb2:

• d6etbb2 first appeared in SCOPe 2.07