SCOPe 2.08: Domain d6etbb1: 6etb B:2-249

Lineage for d6etbb1 (6etb B:2-249)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259349] (6 PDB entries)

8. Domain d6etbb1: 6etb B:2-249 [359820]
   Other proteins in same PDB: d6etba2, d6etbb2
   automated match to d4d02a1
   complexed with fe, fmn, o, oxy; mutant

Details for d6etbb1

PDB Entry: 6etb, 1.91 Å

PDB Description: aerobic s262y mutation of e. coli flrd core

PDB Compounds: (B:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d6etbb1:

Sequence; same for both SEQRES and ATOM records:

>d6etbb1 d.157.1.0 (B:2-249) automated matches {Escherichia coli [TaxId: 83333]}
sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
ylkwaady

Timeline for d6etbb1:

• d6etbb1 first appeared in SCOPe 2.07