Lineage for d1hnka2 (1hnk A:175-317)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711668Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 711771Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 711772Species Escherichia coli [TaxId:562] [53913] (9 PDB entries)
  8. 711780Domain d1hnka2: 1hnk A:175-317 [35982]

Details for d1hnka2

PDB Entry: 1hnk (more details), 1.9 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii, apo tetragonal form
PDB Compounds: (A:) beta-ketoacyl-acyl carrier protein synthase III

SCOP Domain Sequences for d1hnka2:

Sequence, based on SEQRES records: (download)

>d1hnka2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

Sequence, based on observed residues (ATOM records): (download)

>d1hnka2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
isthlhadgstelahivdetlaannldrsqldwlvphqanlriisatakklgmsmdnvvv
tldrhgntsaasvpcaldeavrdgrikpgqlvlleafftwgsalvrf

SCOP Domain Coordinates for d1hnka2:

Click to download the PDB-style file with coordinates for d1hnka2.
(The format of our PDB-style files is described here.)

Timeline for d1hnka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnka1