SCOPe 2.08: Domain d6fohb_: 6foh B:

Lineage for d6fohb_ (6foh B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.177: FAH [56528] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure

4. Superfamily d.177.1: FAH [56529] (2 families)

5. Family d.177.1.1: FAH [56530] (7 proteins)
   automatically mapped to Pfam PF01557

6. Protein automated matches [191123] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [359812] (2 PDB entries)

8. Domain d6fohb_: 6foh B: [359814]
   automated match to d1sawb_
   complexed with cl, mg

Details for d6fohb_

PDB Entry: 6foh, 1.56 Å

PDB Description: x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) at 1.56a resolution.

PDB Compounds: (B:) Acylpyruvase FAHD1, mitochondrial

SCOPe Domain Sequences for d6fohb_:

Sequence; same for both SEQRES and ATOM records:

>d6fohb_ d.177.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrn
lhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksfta
scpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdi
iltgtpkgvgpvkendeieagihglvsmtfkvekpey

Timeline for d6fohb_:

• d6fohb_ first appeared in SCOPe 2.07