SCOPe 2.08: Domain d6dxla_: 6dxl A:

Lineage for d6dxla_ (6dxl A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.387: STING C-terminal-like [254119] (1 superfamily)
   5 helices and 5 strands in one mixed beta-sheet, one long bent helix

4. Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families)
   Pfam PF15009, PubMed 22579474

5. Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254420] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254863] (48 PDB entries)

8. Domain d6dxla_: 6dxl A: [359802]
   automated match to d4f5wa_
   protein/DNA complex; complexed with ca, hg4

Details for d6dxla_

PDB Entry: 6dxl, 2.45 Å

PDB Description: linked amidobenzimidazole sting agonist

PDB Compounds: (A:) Stimulator of interferon protein

SCOPe Domain Sequences for d6dxla_:

Sequence, based on SEQRES records:

>d6dxla_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
smadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfams
qysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrh
lrqeekeevtv

Sequence, based on observed residues (ATOM records):

>d6dxla_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
smadpnirfldklpqqysnsiyellengqragtcvleyatplqtlfamsqysqagfsred
rleqaklfcrtlediladapesqnncrliayqepadfslsqevlrhlrqeekeevtv

Timeline for d6dxla_:

• d6dxla_ first appeared in SCOPe 2.07