Lineage for d6ce5a_ (6ce5 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. Protein automated matches [336961] (2 species)
    not a true protein
  7. Species Rous sarcoma virus [TaxId:11888] [359188] (4 PDB entries)
  8. Domain d6ce5a_: 6ce5 A: [359774]
    automated match to d1a6sa_

Details for d6ce5a_

PDB Entry: 6ce5 (more details)

PDB Description: nmr structure of the rous sarcoma virus matrix protein (m-domain) in the presence of myo-inositol hexakisphosphate
PDB Compounds: (A:) virus matrix protein (M-domain)

SCOPe Domain Sequences for d6ce5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ce5a_ a.61.1.4 (A:) automated matches {Rous sarcoma virus [TaxId: 11888]}
seavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
ramilgksgelktwglvlgalkaaree

SCOPe Domain Coordinates for d6ce5a_ are not available.

Timeline for d6ce5a_: