![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (5 proteins) |
![]() | Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53913] (6 PDB entries) |
![]() | Domain d1eblb2: 1ebl B:175-317 [35976] |
PDB Entry: 1ebl (more details), 1.8 Å
SCOP Domain Sequences for d1eblb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eblb2 c.95.1.1 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli} isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannnd rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik pgqlvlleafgggftwgsalvrf
Timeline for d1eblb2: