SCOP 1.55: Domain d1eblb2: 1ebl B:175-317

Lineage for d1eblb2 (1ebl B:175-317)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
4. Superfamily c.95.1: Thiolase-like [53901] (2 families)
5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (1 species)
7. Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)

8. Domain d1eblb2: 1ebl B:175-317 [35976]

Details for d1eblb2

PDB Entry: 1ebl, 1.8 Å

PDB Description: the 1.8 a crystal structure and active site architecture of beta- ketoacyl-[acyl carrier protein] synthase iii (fabh) from escherichia coli

SCOP Domain Sequences for d1eblb2:

Sequence; same for both SEQRES and ATOM records:

>d1eblb2 c.95.1.1 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannnd
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

Timeline for d1eblb2:

• d1eblb2 appears in SCOP 1.57
  
• d1eblb2 appears in the current release, SCOPe 2.08