Lineage for d6aa8b2 (6aa8 B:184-280)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334652Species Clostridium acetobutylicum [TaxId:272562] [359751] (2 PDB entries)
  8. 2334654Domain d6aa8b2: 6aa8 B:184-280 [359759]
    Other proteins in same PDB: d6aa8a1, d6aa8b1, d6aa8b3, d6aa8c1, d6aa8d1, d6aa8e1, d6aa8f1
    automated match to d4r1na2
    complexed with nad

Details for d6aa8b2

PDB Entry: 6aa8 (more details), 2.1 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+
PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6aa8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aa8b2 a.100.1.0 (B:184-280) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
gfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldiclaimd
vlysetgdskyrphtllkkyvragwlgrksgkgfydy

SCOPe Domain Coordinates for d6aa8b2:

Click to download the PDB-style file with coordinates for d6aa8b2.
(The format of our PDB-style files is described here.)

Timeline for d6aa8b2: