| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Clostridium acetobutylicum [TaxId:272562] [359751] (2 PDB entries) |
| Domain d6acqf2: 6acq F:184-281 [359755] Other proteins in same PDB: d6acqa1, d6acqb1, d6acqb3, d6acqc1, d6acqd1, d6acqe1, d6acqf1, d6acqf3 automated match to d4r1na2 |
PDB Entry: 6acq (more details), 2.5 Å
SCOPe Domain Sequences for d6acqf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6acqf2 a.100.1.0 (F:184-281) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
gfvvnrilipmineavgilaegiasvedidkamklganhpmgplelgdfigldiclaimd
vlysetgdskyrphtllkkyvragwlgrksgkgfydys
Timeline for d6acqf2: