Lineage for d1eblb1 (1ebl B:1-174)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75535Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 75536Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 75537Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 75631Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 75632Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)
  8. 75639Domain d1eblb1: 1ebl B:1-174 [35975]

Details for d1eblb1

PDB Entry: 1ebl (more details), 1.8 Å

PDB Description: the 1.8 a crystal structure and active site architecture of beta- ketoacyl-[acyl carrier protein] synthase iii (fabh) from escherichia coli

SCOP Domain Sequences for d1eblb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eblb1 c.95.1.1 (B:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

SCOP Domain Coordinates for d1eblb1:

Click to download the PDB-style file with coordinates for d1eblb1.
(The format of our PDB-style files is described here.)

Timeline for d1eblb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eblb2