Lineage for d6c39b2 (6c39 B:316-383)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. Protein automated matches [231758] (5 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:1280] [352209] (2 PDB entries)
  8. Domain d6c39b2: 6c39 B:316-383 [359748]
    Other proteins in same PDB: d6c39a1, d6c39b1
    automated match to d3huma2
    complexed with na, so4, zn

Details for d6c39b2

PDB Entry: 6c39 (more details), 1.6900000000000002 Å

PDB Description: apo crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4)
PDB Compounds: (B:) Serine-type D-Ala-D-Ala carboxypeptidase

SCOPe Domain Sequences for d6c39b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c39b2 b.105.1.0 (B:316-383) automated matches {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOPe Domain Coordinates for d6c39b2 are not available.

Timeline for d6c39b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c39b1
View in 3D
Domains from other chains:
(mouse over for more information)
d6c39a1, d6c39a2