Lineage for d6aa8c1 (6aa8 C:2-183)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454935Species Clostridium acetobutylicum [TaxId:272562] [359731] (2 PDB entries)
  8. 2454938Domain d6aa8c1: 6aa8 C:2-183 [359745]
    Other proteins in same PDB: d6aa8a2, d6aa8b2, d6aa8b3, d6aa8c2, d6aa8d2, d6aa8e2, d6aa8f2
    automated match to d4kuea1
    complexed with nad

Details for d6aa8c1

PDB Entry: 6aa8 (more details), 2.1 Å

PDB Description: crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+
PDB Compounds: (C:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6aa8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aa8c1 c.2.1.0 (C:2-183) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
kkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieeat
kveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntsslsi
tevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpvevae
ap

SCOPe Domain Coordinates for d6aa8c1:

Click to download the PDB-style file with coordinates for d6aa8c1.
(The format of our PDB-style files is described here.)

Timeline for d6aa8c1: