| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (309 species) not a true protein |
| Species Clostridium acetobutylicum [TaxId:272562] [359731] (2 PDB entries) |
| Domain d6acqe1: 6acq E:1-183 [359740] Other proteins in same PDB: d6acqa2, d6acqb2, d6acqb3, d6acqc2, d6acqd2, d6acqe2, d6acqf2, d6acqf3 automated match to d4kuea1 |
PDB Entry: 6acq (more details), 2.5 Å
SCOPe Domain Sequences for d6acqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6acqe1 c.2.1.0 (E:1-183) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
mkkvcvigagtmgsgiaqafaakgfevvlrdikdefvdrgldfinknlsklvkkgkieea
tkveiltrisgtvdlnmaadcdlvieaavermdikkqifadldnickpetilasntssls
itevasatkrpdkvigmhffnpapvmklvevirgiatsqetfdavketsiaigkdpveva
eap
Timeline for d6acqe1: